PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do029529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 153aa    MW: 16892.1 Da    PI: 7.0426
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do029529.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.3e-1688140355
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                 +++r +r+++NRe+A rsR+RK+a++e+Le++v  L  eN +Lkk+ +e  k+
  Do029529.1  88 DDRRSIRMMRNRESALRSRARKRAYVENLEKEVRRLVDENLKLKKQCKEVLKH 140
                 5799************************************7777776665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.0E-1186151IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-1487140No hitNo description
PROSITE profilePS5021710.54288133IPR004827Basic-leucine zipper domain
PfamPF001708.6E-1489142IPR004827Basic-leucine zipper domain
CDDcd147073.71E-1890136No hitNo description
SuperFamilySSF579598.13E-1290139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MAANYHHYQM AVHAAAAAAA AWREPDSPQL SFVSGCSSLF SISTLQDDDD GAVVIAGHAM  60
PSTPVSLAGF AGDEVDMEVQ QISGGSGDDR RSIRMMRNRE SALRSRARKR AYVENLEKEV  120
RRLVDENLKL KKQCKEVLKH SEPCMSSALF IYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0338581e-120BT033858.1 Zea mays full-length cDNA clone ZM_BFc0165B20 mRNA, complete cds.
GenBankJX4699611e-120JX469961.1 Zea mays subsp. mays clone UT3223 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966480.16e-87PREDICTED: protein FD-like
TrEMBLK3XZQ17e-87K3XZQ1_SETIT; Uncharacterized protein
STRINGSi007412m2e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.11e-11bZIP family protein